Scaffold WOR_103329

Overview

Basic Information

• Taxon OID: 3300000393
• Scaffold ID: WOR_103329
• Source Dataset Name: GB background transcript assembly
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Pennsylvania State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1149
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Hydrothermal Vent Microbial Communities From Guaymas And Carmen Basins, Gulf Of California

Source Dataset Sampling Location

• Location Name: Guaymas Basin, Gulf of California
• Coordinates
  • Lat. (^o): 27.506
  • Long. (^o): -111.347
  • Depth (m): 1990

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059606	Metagenome / Metatranscriptome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
WOR_1033292	F059606	GGTGG	LCKGAIDLASKLFEGSRHISIESPLLIVIGVVAIIASAMLWTGRYLAGGVTNIILGIITVFYGKDAEGLMILISGVLGIVAPKIKD*