Basic Information | |
---|---|
Taxon OID | 3300000371 Open in IMG/M |
Scaffold ID | P_1C_Liq_3_UnCtyDRAFT_1016646 Open in IMG/M |
Source Dataset Name | Marine microbial community from Union City, CA, USA - Pond 1C Liquid 3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 552 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Eden Landing Ponds, San Francisco, CA, USA | |||||||
Coordinates | Lat. (o) | 37.5693 | Long. (o) | -122.102517 | Alt. (m) | Depth (m) | .29 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F027015 | Metagenome | 196 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
P_1C_Liq_3_UnCtyDRAFT_10166461 | F027015 | N/A | MNLIFLYLFILYMFHKASTEAERQKLFDDYMLRILKEKEVIKKNKKIIDDQDFIFDPTIDEEKVKGAFNSYVDSLVVKNFLIEQIHTRLKINKNMAMQFVNKLDGNQVLILSKVINEFIKDIQDKYVSINDYILKRSFDELQGTYNVVQQQEKDNEIVRQNQVEQGEVLQE |
⦗Top⦘ |