Scaffold P_1C_Liq_3_UnCtyDRAFT_1007545

Overview

Basic Information

• Taxon OID: 3300000371
• Scaffold ID: P_1C_Liq_3_UnCtyDRAFT_1007545
• Source Dataset Name: Marine microbial community from Union City, CA, USA - Pond 1C Liquid 3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 848
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Varidnaviria → Bamfordvirae → Preplasmiviricota → Maveriviricetes → Priklausovirales → Lavidaviridae → unclassified Lavidaviridae → Organic Lake virophage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Source Dataset Sampling Location

• Location Name: Eden Landing Ponds, San Francisco, CA, USA
• Coordinates
  • Lat. (^o): 37.5693
  • Long. (^o): -122.102517
  • Depth (m): .29

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026806	Metagenome	196	Y

Sequences

Protein ID	Family	RBS	Sequence
P_1C_Liq_3_UnCtyDRAFT_10075452	F026806	N/A	IMLNRALYRLFNSLPFKLVNKTFNTLDETTQTTRSQILYKLNLSNFKNANEVEIYPHLSNNNSGLTKTTHMLIYQDYETLSTWSPVESIVIIAPNFPIKSNEVSADVEYVDGFPTVIGEVRHESEILEISTNSPVPAIIYEPKHYRFMSMKQTDSGLRNIMFKIYYRFKNNGSLIPVKANLGGSFSLKLMFRKIN*