Basic Information | |
---|---|
Taxon OID | 3300000362 Open in IMG/M |
Scaffold ID | SL_1KL_011_SEDDRAFT_10013152 Open in IMG/M |
Source Dataset Name | Alkaline sediment microbial communities from Cock Soda Lake, Kulunda Steppe, Russia - 1KL_011_SED |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4745 |
Total Scaffold Genes | 8 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (62.50%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Russia: Kulunda Steppe, Cock Lake | |||||||
Coordinates | Lat. (o) | 52.06 | Long. (o) | 79.09 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F045771 | Metagenome | 152 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
SL_1KL_011_SEDDRAFT_100131523 | F045771 | N/A | MTRRVFLDTEWTGPPWSSRSQPMWIGLADEGGRSWYGISSEANIDPSTNDFIAGVFRLITPDEPRLTHQELAAAIIAFCGDVDEFWAWRALSG* |
⦗Top⦘ |