Scaffold OctSS_8084CDRAFT_1007325

Overview

Basic Information

• Taxon OID: 3300000345
• Scaffold ID: OctSS_8084CDRAFT_1007325
• Source Dataset Name: Hot spring and microbial mat streamer communities from Octopus Spring Streamers, Yellowstone National Park, USA - T=80-84
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1341
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis → Thermocrinis ruber (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring And Microbial Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Octopus Spring Streamers, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.5340836
  • Long. (^o): -110.7978895

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043237	Metagenome / Metatranscriptome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
OctSS_8084CDRAFT_10073252	F043237	GGAGG	MELERTARYIAQLSSRGYKYAVVGKLARYDKKIVKKLEYEGFVFYLCRFQTKKEVVEYCLERAEGTFRVYCLASKPLEFPNAPLKLHYDEKTKRLRLLAQRSFINECLKVIERASSLKYPNHKLYTAKVNEALRNLYSILAYTYNDRERLRAIKRKVKHLFVEALKKNYGIEPKKAMEDYRRFVVKFSDVLKKKQRANSSTS*