NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Cc92DRAFT_1006006

Scaffold Cc92DRAFT_1006006


Overview

Basic Information
Taxon OID3300000303 Open in IMG/M
Scaffold IDCc92DRAFT_1006006 Open in IMG/M
Source Dataset NameCECUM_9-2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity College Cork
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11287
Total Scaffold Genes24 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (20.83%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Birds → Digestive System → Ceca → Unclassified → Chicken Cecum → Chicken Cecum Microbial Communities From Ireland

Source Dataset Sampling Location
Location NameIreland: Cork
CoordinatesLat. (o)51.897783Long. (o)-8.470613Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053097Metagenome / Metatranscriptome141Y

Sequences

Protein IDFamilyRBSSequence
Cc92DRAFT_10060067F053097N/AMFDIKGDKIVFSTQDLAIPPFKEFYNNAKDKNLAKKQLEYVIWRYKWNTPYEAYPESERSERVALDVFGTNYEPDASVKELIKRFNEF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.