NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold EM338_1074872

Scaffold EM338_1074872


Overview

Basic Information
Taxon OID3300000297 Open in IMG/M
Scaffold IDEM338_1074872 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from Cork, Ireland - EM338
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI), Macrogen
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2238
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (42.86%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → unclassified Oscillospiraceae → Ruminococcaceae bacterium LM158(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From University College Cork, Ireland, Of The Elderly Irish Population

Source Dataset Sampling Location
Location NameCork, Ireland
CoordinatesLat. (o)51.907Long. (o)-8.472Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F068855Metagenome124N

Sequences

Protein IDFamilyRBSSequence
EM338_10748722F068855N/ATMVPTISRCPSSSVPTVEAQGPQVRKNLAPQGLQAEKERENANVQNAGWLHSFDADYHYRGSDLHYHVNVSAALSEGGAVW*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.