Scaffold EM232_1062454

Overview

Basic Information

• Taxon OID: 3300000282
• Scaffold ID: EM232_1062454
• Source Dataset Name: Human fecal microbial communities from Cork, Ireland - EM232
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Genomics Institute (BGI), Macrogen
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 21213
• Total Scaffold Genes: 55
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 19 (34.55%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From University College Cork, Ireland, Of The Elderly Irish Population

Source Dataset Sampling Location

• Location Name: Cork, Ireland
• Coordinates
  • Lat. (^o): 51.907
  • Long. (^o): -8.472

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083451	Metagenome	113	N

Sequences

Protein ID	Family	RBS	Sequence
EM232_106245450	F083451	N/A	MIMDKNEREKQVLDLLMSRKDIRKLVEKSNECYSKMDFVGAMKCRQEIKDIVDRESKIMLTKSESLVSLMNNADNEYKFNMLVWLHSMMCMADVFNGILEDFKDGVRKANGNSKFVKFDNLDRLMTECKKEIDYLMKGTSKSFQISFAVRSDELGEMIKNMVGDNIREGYDIFKEEAKMTKETDRSKIEEFNKRLNHE*