Scaffold LP_A_09_P04_1300DRAFT_1026434

Overview

Basic Information

• Taxon OID: 3300000262
• Scaffold ID: LP_A_09_P04_1300DRAFT_1026434
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_1300
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 934
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → unclassified Oceanospirillaceae → Oceanospirillaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Line P, Station P4
• Coordinates
  • Lat. (^o): 48.65
  • Long. (^o): -126.666667
  • Depth (m): 1300

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062189	Metagenome / Metatranscriptome	131	Y

Sequences

Protein ID	Family	RBS	Sequence
LP_A_09_P04_1300DRAFT_10264342	F062189	AGGA	MTNPTKLTPQQQLRNPFCKRAMRFSKEGYEALMSAKRQLEAKLERPISESVAINMVLLGDSLS*