Scaffold LP_A_09_P20_1000DRAFT_1006088

Overview

Basic Information

• Taxon OID: 3300000261
• Scaffold ID: LP_A_09_P20_1000DRAFT_1006088
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P20_1000
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1877
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Line P, Starion P20
• Coordinates
  • Lat. (^o): 49.566667
  • Long. (^o): -138.666667
  • Depth (m): 1000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069480	Metagenome	124	N

Sequences

Protein ID	Family	RBS	Sequence
LP_A_09_P20_1000DRAFT_10060881	F069480	N/A	MRLVPNHIELIDRIYILESRNNIKRVEGNAGQILDEAPKNKPYNTVKTVFFSVFKPEFFSENIQ