Scaffold LP_J_08_P26_500DRAFT_1054387

Overview

Basic Information

• Taxon OID: 3300000259
• Scaffold ID: LP_J_08_P26_500DRAFT_1054387
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_J_08_P26_500
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 507
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: P26, Pacific Ocean
• Coordinates
  • Lat. (^o): 50.0
  • Long. (^o): -145.0
  • Depth (m): 500

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081213	Metagenome / Metatranscriptome	114	N

Sequences

Protein ID	Family	RBS	Sequence
LP_J_08_P26_500DRAFT_10543872	F081213	AGGAG	MKKLVCTLLLLCSTSSFSALGDNWNEKLLLEYKDYTGAVLGAMANYHIRCGGISALGGDFIEKAVEIHGFSTEDTQTNPYYARGYDQADSMTCQKLRRGFTMLNIVHLLAEGEHYDD*