NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LP_J_08_P26_500DRAFT_1033677

Scaffold LP_J_08_P26_500DRAFT_1033677


Overview

Basic Information
Taxon OID3300000259 Open in IMG/M
Scaffold IDLP_J_08_P26_500DRAFT_1033677 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_J_08_P26_500
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)688
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameP26, Pacific Ocean
CoordinatesLat. (o)50.0Long. (o)-145.0Alt. (m)Depth (m)500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012125Metagenome283Y

Sequences

Protein IDFamilyRBSSequence
LP_J_08_P26_500DRAFT_10336773F012125N/AMCYNVMKPDSGRKSFFSAGKPKNLPAFYFLVVAGIILMVLLFKWFV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.