NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LP_F_10_SI03_120DRAFT_1003325

Scaffold LP_F_10_SI03_120DRAFT_1003325


Overview

Basic Information
Taxon OID3300000256 Open in IMG/M
Scaffold IDLP_F_10_SI03_120DRAFT_1003325 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - ample_F_10_SI03_120
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5780
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (37.50%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameLine P, North Pacific Ocean
CoordinatesLat. (o)48.35Long. (o)-123.3Alt. (m)Depth (m)120
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004439Metagenome438Y

Sequences

Protein IDFamilyRBSSequence
LP_F_10_SI03_120DRAFT_10033254F004439N/AMKRFKEYLKEARGTSLSGLLFLPRIGYYDQLMIPISSSMFKRIWPDTLRATVFHTTDGDGVRNIAKLQGKKKQISAFFSMFSRYMEVGVATQGGVHSVLEMDADVLLSAKGDVMSHLDQNGRRWTSISDLKETSRWTKFTAVEKDLEKMFDALVKKYLKRGEFQENATVWELWRMAERKVDKKTMSLIIKDYMDGMEKVIKKNIDTFENAMLSYAKKRSTDLSWDEQIVNNFKVKTAHFFKLKLKIAQTEKEASLYPEHQELMEFAKSKGWKVKVWDAPIELEIYTREVAKKELGK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.