Scaffold LP_F_10_SI03_135DRAFT_1053397

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold LP_F_10_SI03_135DRAFT_1053397

Scaffold LP_F_10_SI03_135DRAFT_1053397

Overview

Basic Information
Taxon OID	3300000255 Open in IMG/M
Scaffold ID	LP_F_10_SI03_135DRAFT_1053397 Open in IMG/M
Source Dataset Name	Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_F_10_SI03_135
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	575
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location Name	Line P, North Pacific Ocean
Coordinates	Lat. (^o)	48.35	Long. (^o)	-123.3	Alt. (m)		Depth (m)	135
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100885	Metagenome / Metatranscriptome	102	N

Sequences

Protein ID	Family	RBS	Sequence
LP_F_10_SI03_135DRAFT_10533971	F100885	N/A	MAERISGIALMPRQSRNGVYYDVEELKKFDGKTVPLRVEHDKDTHIGQVTFSFDEEKSQVKYEATIFDSEWQHILNNEQYQVSIG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.