Scaffold BS_KBA_SWE21_205mDRAFT_10045594

Overview

Basic Information

• Taxon OID: 3300000241
• Scaffold ID: BS_KBA_SWE21_205mDRAFT_10045594
• Source Dataset Name: Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 21_20.5m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1048
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Wetlands → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location

• Location Name: KBB site, Vaertahamnen, Baltic Sea, Sweden
• Coordinates
  • Lat. (^o): 59.350163
  • Long. (^o): 18.107847
  • Depth (m): 20.5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081923	Metagenome / Metatranscriptome	114	N

Sequences

Protein ID	Family	RBS	Sequence
BS_KBA_SWE21_205mDRAFT_100455943	F081923	N/A	KETAELNRTALAAACTMANIGSVRTSPEVTRQFESLQIHPNYRYWYLNQENNPYGVIGLDREYEFDGGPVWRAVEPDSPTFKKVVGLVASFPMPSSMTTGYTIFEHQGRPIGVWYSSIGLGVTIDPATKTVSPSTTSPWKSPY*