Scaffold TB_GS09_5DRAFT_10010135

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold TB_GS09_5DRAFT_10010135

Scaffold TB_GS09_5DRAFT_10010135

Overview

Basic Information
Taxon OID	3300000234 Open in IMG/M
Scaffold ID	TB_GS09_5DRAFT_10010135 Open in IMG/M
Source Dataset Name	Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- GS09_5
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	7760
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater → Groundwater Microbial Communities From Subsurface Biofilms In Sulfidic Aquifier In Frasassi Gorge, Italy

Source Dataset Sampling Location
Location Name	Grotta Sulfurea, Talus Pool, Frasassi Caves, Italy
Coordinates	Lat. (^o)	43.383333	Long. (^o)	12.95	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065185	Metagenome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
TB_GS09_5DRAFT_100101356	F065185	N/A	MSVLKKKSMKIIFEDKSYISVEKSSKDDHIVIIIQAKDAENPQKKITNAVEITLDQFKSLTSLM*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.