Scaffold TB_LI09_4DRAFT_10192410

Overview

Basic Information

• Taxon OID: 3300000231
• Scaffold ID: TB_LI09_4DRAFT_10192410
• Source Dataset Name: Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 668
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater → Groundwater Microbial Communities From Subsurface Biofilms In Sulfidic Aquifier In Frasassi Gorge, Italy

Source Dataset Sampling Location

• Location Name: Lago Infinito, wall in 6.8 m depth, Frasassi Caves, Italy
• Coordinates
  • Lat. (^o): 43.383333
  • Long. (^o): 12.95
  • Depth (m): 6.8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033261	Metagenome / Metatranscriptome	178	Y

Sequences

Protein ID	Family	RBS	Sequence
TB_LI09_4DRAFT_101924101	F033261	N/A	DHWGQEFGHRVGKHDLCLDILPPGYVLRTQRDDQGQLQRTVEYDQTAFFLAAWLRCLVFNLLSRFAQALGGEYTKMWAGTLLRKFIRRPATLYLVGNELHVVFDPFPGQEELQPLLDRLNAKRTALPWLNNLVVQLSLFSAP*