Scaffold TB_GS10_10DRAFT_10157486

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold TB_GS10_10DRAFT_10157486

Scaffold TB_GS10_10DRAFT_10157486

Overview

Basic Information
Taxon OID	3300000230 Open in IMG/M
Scaffold ID	TB_GS10_10DRAFT_10157486 Open in IMG/M
Source Dataset Name	Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- GS10_10
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	765
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater → Groundwater Microbial Communities From Subsurface Biofilms In Sulfidic Aquifier In Frasassi Gorge, Italy

Source Dataset Sampling Location
Location Name	Grotta Sulfurea, Talus Pool, Frasassi Caves, Italy
Coordinates	Lat. (^o)	43.383333	Long. (^o)	12.95	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093840	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
TB_GS10_10DRAFT_101574861	F093840	N/A	PKLISDDVKIVFSRFKSLSKYLDMIDYAKNEVDLYFGIKCDGKLEYGISYEESLPIGQFKLSQSVIKWIVQLDLKSANSLKKELVNLSYQDIILLGKIRNDMKDFTPGYHEQKSKPTLIDKVFTFGYYGIGKWDNGKLDEGELFNIKGNFSNWILSKKWSDKVLISVKAQSFWLNIHIKLK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.