NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LowMDraftT1_c079473

Scaffold LowMDraftT1_c079473


Overview

Basic Information
Taxon OID3300000210 Open in IMG/M
Scaffold IDLowMDraftT1_c079473 Open in IMG/M
Source Dataset NameSheep rumen microbial communities from New Zealand - Low methane emitting sheep
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)872
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Sheep Rumen → Sheep Rumen Microbial Communities From New Zealand From High And Low Methane Emitting Sheep

Source Dataset Sampling Location
Location NameHamilton, New Zealand
CoordinatesLat. (o)-45.483333Long. (o)170.716667Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056990Metagenome / Metatranscriptome137Y

Sequences

Protein IDFamilyRBSSequence
LowMDraftT1_0794731F056990N/AMSESLEIKKAKIDSLVAGFTNSGYKSGSRVGQTELIQFLNRRSKSGRFDPIISEKLFQVMSLEASSTLSVEEFINGFLQFEEELRKNAESFSMKLAKEEEIFAQIEDEYRRYREEHLNAEGLSDTAKISGEITEIDIKRKLEGIKEIMIKVVFNDKSEELHFKIGDINSSEMEHKTFEFKPTSRKDHFEFIMKGINERNQIFDIGSKVFPLTDINSNEQYLVQIVVPEI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.