Scaffold NICFPass4AFXDRAFT_c001079

Overview

Basic Information

• Taxon OID: 3300000208
• Scaffold ID: NICFPass4AFXDRAFT_c001079
• Source Dataset Name: Feedstock adapted compost microbial communities from Newby Island compost facility, Milpitas, CA, USA - Passage 4_AFX
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 18793
• Total Scaffold Genes: 22
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 19 (86.36%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost → Feedstock Adapted Compost Microbial Communities From Newby Island Compost Facility, Milpitas Ca

Source Dataset Sampling Location

• Location Name: Newby Island compost facility, Milpitas, CA
• Coordinates
  • Lat. (^o): 37.454581
  • Long. (^o): -121.928712

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036417	Metagenome / Metatranscriptome	170	Y

Sequences

Protein ID	Family	RBS	Sequence
NICFPass4AFXDRAFT_00107918	F036417	AGG	LPRRRGFAICFRAMVYPARVPLRTRIPTVLVRLATDDGEVVFRARWTRSPLELQRNILFRMRRGSLLWFQDEWGHDLCFRPECVYAAMVDGR