NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold TB18AUG2009E_c000066

Scaffold TB18AUG2009E_c000066


Overview

Basic Information
Taxon OID3300000203 Open in IMG/M
Scaffold IDTB18AUG2009E_c000066 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)30230
Total Scaffold Genes37 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)30 (81.08%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.0412Long. (o)-89.6864Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000324Metagenome / Metatranscriptome1299Y
F013852Metagenome / Metatranscriptome267N

Sequences

Protein IDFamilyRBSSequence
TB18AUG2009E_0000662F013852AGGAMARSTFSGPILSGQNRFGPIRDIGYTDLVQTALLDFSVTSPGANYGGASGVFVASNNIPNSAATIYTPQSGVFSNSGPTKASAPTADATNLVYRGVVFYVPYSCNITDVILDIGTIPKDNAGTPVAVSAIQPYVSNNFATSTGVYATFSNISSPATQRYTGTFVGSQLTNSNATLQDFQNPNVGQDPAWFGQIVVTLAMTTTAAGLSSGQVEVTIRYNQNDMNIGTSSAYPYGNFD*
TB18AUG2009E_00006623F000324AGGAMTTPIAPHHQLTYDGAVLNIFHANKGEGLPRHEHTWAHATMCHAGSCIVRKEGRELVMTKETQPVNLVANEWHEIEALEDGTVFVNVFAEGKY*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.