Scaffold LPjun09P161000mDRAFT_c1018266

Overview

Basic Information

• Taxon OID: 3300000190
• Scaffold ID: LPjun09P161000mDRAFT_c1018266
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P16 1000m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1251
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: P16, Pacific Ocean
• Coordinates
  • Lat. (^o): 49.283333
  • Long. (^o): -134.666667
  • Depth (m): 1000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050662	Metagenome	145	N

Sequences

Protein ID	Family	RBS	Sequence
LPjun09P161000mDRAFT_10182661	F050662	N/A	IFERIKSAGGEYALFAVEDTGYEKLQINFTDIRNKLAEQRQLLLAYREYYEPVDQSE*