Scaffold SI53jan11_100mDRAFT_c1039467

Overview

Basic Information

• Taxon OID: 3300000187
• Scaffold ID: SI53jan11_100mDRAFT_c1039467
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 53 01/11/11 100m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 619
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Saanich Inlet 53, Vancouver Island, BC, Canada
• Coordinates
  • Lat. (^o): 48.6
  • Long. (^o): -123.5
  • Depth (m): 100

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015024	Metagenome / Metatranscriptome	258	N

Sequences

Protein ID	Family	RBS	Sequence
SI53jan11_100mDRAFT_10394671	F015024	AGGAG	MEYTEYYELFKQYPEWEVEHENHKEGFNGKRNFELEKAITKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEE