Basic Information | |
---|---|
Taxon OID | 3300000178 Open in IMG/M |
Scaffold ID | FW301_c1039016 Open in IMG/M |
Source Dataset Name | Pristine groundwater from Oak Ridge Integrated Field Research Center, Tennessee (resequenced) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 608 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Oak Ridge Integrated Field Research Center, Tennessee, That Are Pristine And Uranium Contaminated |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Oak Ridge, Tennessee, USA | |||||||
Coordinates | Lat. (o) | 36.11569 | Long. (o) | -84.248657 | Alt. (m) | Depth (m) | 21 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F014640 | Metagenome / Metatranscriptome | 261 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
FW301_10390162 | F014640 | N/A | QQVLQSKRSLAFSAFQSALEARLKQEGKLKIMPDRLKGFGNFQEPLT* |
⦗Top⦘ |