Scaffold FW301_c1030217

Overview

Basic Information

• Taxon OID: 3300000178
• Scaffold ID: FW301_c1030217
• Source Dataset Name: Pristine groundwater from Oak Ridge Integrated Field Research Center, Tennessee (resequenced)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 675
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Oak Ridge Integrated Field Research Center, Tennessee, That Are Pristine And Uranium Contaminated

Source Dataset Sampling Location

• Location Name: Oak Ridge, Tennessee, USA
• Coordinates
  • Lat. (^o): 36.11569
  • Long. (^o): -84.248657
  • Depth (m): 21

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032725	Metagenome / Metatranscriptome	179	Y

Sequences

Protein ID	Family	RBS	Sequence
FW301_10302171	F032725	GAGG	MPRIRTSALALCGIVSLASCLLLAQTQRPGEYPRGEKPSPMMSFFVTSVPVGDGGNLGGL