Scaffold TB03JUN2009E_c000310

Overview

Basic Information

• Taxon OID: 3300000176
• Scaffold ID: TB03JUN2009E_c000310
• Source Dataset Name: Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 15144
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (14.29%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Trout Bog, Vilas County, Wisconsin, USA
• Coordinates
  • Lat. (^o): 46.0412
  • Long. (^o): -89.6864

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002045	Metagenome / Metatranscriptome	599	Y

Sequences

Protein ID	Family	RBS	Sequence
TB03JUN2009E_00031011	F002045	N/A	MKFFCVYVKTRKKLDKYVKVNRIKNKYIIDIKKIIEEEEVDFDSEKTYLKILIFNKIQQAVEKKKDIYYIPDFEEQFSIDKLLNIKKILGKDNEFNVLIFYNEFRKEQNILDDVLGSLSKFSNSQIIRDY*