Scaffold SI54feb11_100mDRAFT_c1056797

Overview

Basic Information

• Taxon OID: 3300000158
• Scaffold ID: SI54feb11_100mDRAFT_c1056797
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 54 02/08/11 100m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 526
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Saanich Inlet 54, Vancouver Island, BC, Canada
• Coordinates
  • Lat. (^o): 48.6
  • Long. (^o): -123.5
  • Depth (m): 100

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024126	Metagenome / Metatranscriptome	207	Y

Sequences

Protein ID	Family	RBS	Sequence
SI54feb11_100mDRAFT_10567971	F024126	N/A	HANKILNKAGMPSLKEEDTPAECDDCGSGDIARPKPENRKILQQLFTCFVNNNDQTMEDVGRMLERDLEVADNCYLLLLKNYYVNDVTGKIDKKKTKIKELIRIDPPQVAIIADSDGRVGFDDKRNAVYVCPRFEHRDKRLTKPHCDRCGAEALKALLEVSSVYSVGIPQPKRVI