Scaffold SI47jul10_100mDRAFT_c1010969

Overview

Basic Information

• Taxon OID: 3300000148
• Scaffold ID: SI47jul10_100mDRAFT_c1010969
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 100m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1812
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Saanich Inlet 47, Vancouver Island, BC, Canada
• Coordinates
  • Lat. (^o): 48.6
  • Long. (^o): -123.5
  • Depth (m): 100

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025852	Metagenome / Metatranscriptome	200	Y

Sequences

Protein ID	Family	RBS	Sequence
SI47jul10_100mDRAFT_10109691	F025852	N/A	MDIITYIDSIGRTCFGELVERTDDGIKVKAPAMIMVTPNDAANMKVDVMPLFFTEFSDGKQPTFTYKNLQFVEVLTDISGKLLEHYAAKINTNGEPN