Scaffold LPjun08P41300mDRAFT_c1026759

Overview

Basic Information

• Taxon OID: 3300000141
• Scaffold ID: LPjun08P41300mDRAFT_c1026759
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P4 1300m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 822
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: P4, Pacific Ocean
• Coordinates
  • Lat. (^o): 48.65
  • Long. (^o): -126.666667
  • Depth (m): 1300

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090333	Metagenome / Metatranscriptome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
LPjun08P41300mDRAFT_10267591	F090333	N/A	KSSQTRKFLEDLSKFSDIPLDDIKIPTTKGGLKENGAVPLEIMKKYFSQSNINRYIATEENMNMGSIVTEHYTKGKKEPAYYMQAGDDFYRISKKDPFNIGRKIPELSGVGDFKVRVATRSQFYEVQAEMKIKKMPNSLYSLKPDTKKKNPFLKY*