Scaffold LPjun08P41300mDRAFT_c1000757

Overview

Basic Information

• Taxon OID: 3300000141
• Scaffold ID: LPjun08P41300mDRAFT_c1000757
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P4 1300m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 6732
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: P4, Pacific Ocean
• Coordinates
  • Lat. (^o): 48.65
  • Long. (^o): -126.666667
  • Depth (m): 1300

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025145	Metagenome / Metatranscriptome	203	Y

Sequences

Protein ID	Family	RBS	Sequence
LPjun08P41300mDRAFT_10007572	F025145	N/A	MNILHNPQFNIKKVTAHYTKKDGVPVHYVCTSDLDESDRPFDIYYRKTPHPVHNNYYFGLYTDEEDRMMICKADSIEKYQFGLIAEPDKDEWVYSQCHHDSVEIDSGFIGGGRRYIKRGGDLDTQEFVVRKVKDGEII*