Scaffold KGI_S2_ANT05_2345mDRAFT_c1025501

Overview

Basic Information

• Taxon OID: 3300000132
• Scaffold ID: KGI_S2_ANT05_2345mDRAFT_c1025501
• Source Dataset Name: Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S2 sample ANT 05_23.45m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1109
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location

• Location Name: S2 site, Potter Cove, King George Island, Antarctic Peninsula
• Coordinates
  • Lat. (^o): -62.231932
  • Long. (^o): -58.655087
  • Depth (m): 23.45

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018541	Metagenome / Metatranscriptome	234	Y

Sequences

Protein ID	Family	RBS	Sequence
KGI_S2_ANT05_2345mDRAFT_10255011	F018541	AGG	MYSPTMRSFWVDFPLNAEQYSKLKLKWRRRQNNYEIQNPLPELRIRSFCTFGGDDYQIISLEVRGGVDDYHAALNVMDKWIVETLGEY*