Scaffold SA_S1_NOR08_45mDRAFT_c10013879

Overview

Basic Information

• Taxon OID: 3300000128
• Scaffold ID: SA_S1_NOR08_45mDRAFT_c10013879
• Source Dataset Name: Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 3586
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (22.22%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location

• Location Name: Norway: Adventfjord, Svalbard Archipelago
• Coordinates
  • Lat. (^o): 78.237209
  • Long. (^o): 15.677776
  • Depth (m): 45

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059369	Metagenome / Metatranscriptome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
SA_S1_NOR08_45mDRAFT_100138798	F059369	N/A	MIVIGILLFIAFVFIMIGHFKDGDIIISPIKGLMFGFLYHKEEYIGENEYTLQCLLGVISLNVIWIKTLDG*