Scaffold SA_S1_NOR05_45mDRAFT_c10114777

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SA_S1_NOR05_45mDRAFT_c10114777

Scaffold SA_S1_NOR05_45mDRAFT_c10114777

Overview

Basic Information
Taxon OID	3300000127 Open in IMG/M
Scaffold ID	SA_S1_NOR05_45mDRAFT_c10114777 Open in IMG/M
Source Dataset Name	Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 05_45m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	598
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location
Location Name	Norway: Adventfjord, Svalbard Archipelago
Coordinates	Lat. (^o)	78.237209	Long. (^o)	15.677776	Alt. (m)		Depth (m)	45
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071751	Metagenome / Metatranscriptome	122	N

Sequences

Protein ID	Family	RBS	Sequence
SA_S1_NOR05_45mDRAFT_101147771	F071751	N/A	MKTILKFTEFVNENLNEANLPSYVKSGPYQTLKDMFAYIGNDIQNADGSELTIADVNKNYKPALKYLGVRSIADMGMIGDPFDDNDDSDELYDIVAPQMKSSNFLGNDGGKGMNSQPYTGAYKGKVGDIKVIITQDIN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.