Scaffold SA_S1_NOR05_45mDRAFT_c10007264

Overview

Basic Information

• Taxon OID: 3300000127
• Scaffold ID: SA_S1_NOR05_45mDRAFT_c10007264
• Source Dataset Name: Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 05_45m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 3495
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location

• Location Name: Norway: Adventfjord, Svalbard Archipelago
• Coordinates
  • Lat. (^o): 78.237209
  • Long. (^o): 15.677776
  • Depth (m): 45

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084398	Metagenome / Metatranscriptome	112	N

Sequences

Protein ID	Family	RBS	Sequence
SA_S1_NOR05_45mDRAFT_100072644	F084398	AGGA	MARLELTLNFPKSFQIKTFNVKSEKKLSPLAKIILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALSSIVISLQNNLSINFFDMWIYEIYINKVSTQKTNL*VQNPKI*