NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BS_KBB_SWE26_205mDRAFT_c1025070

Scaffold BS_KBB_SWE26_205mDRAFT_c1025070


Overview

Basic Information
Taxon OID3300000126 Open in IMG/M
Scaffold IDBS_KBB_SWE26_205mDRAFT_c1025070 Open in IMG/M
Source Dataset NameMarine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 26_20.5m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)962
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location
Location NameKBB site, Vaertahamnen, Baltic Sea, Sweden
CoordinatesLat. (o)59.350163Long. (o)18.107847Alt. (m)Depth (m)20.5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017987Metagenome237Y
F074791Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
BS_KBB_SWE26_205mDRAFT_10250701F074791AGAAGMSIDTYGLPSEQYEKFFEDNVRFAAQLYLKTCKILTAEGAGSVDFKTVLDMYQETVYATNDDCRRYQKSNNPEALKDNDIFGLSPSREEM
BS_KBB_SWE26_205mDRAFT_10250704F017987N/ASGTPEKCVSWWYAPPADHISDGRFVLLYTNSGAQAPLSHWRTYKPKEIFTQHDAWDLFFNMMEAGYVPFPGTALPQLKSAIKKQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.