Scaffold BS_KBB_SWE26_205mDRAFT_c1009316

Overview

Basic Information

• Taxon OID: 3300000126
• Scaffold ID: BS_KBB_SWE26_205mDRAFT_c1009316
• Source Dataset Name: Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 26_20.5m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1693
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Wetlands → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location

• Location Name: KBB site, Vaertahamnen, Baltic Sea, Sweden
• Coordinates
  • Lat. (^o): 59.350163
  • Long. (^o): 18.107847
  • Depth (m): 20.5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047673	Metagenome / Metatranscriptome	149	Y

Sequences

Protein ID	Family	RBS	Sequence
BS_KBB_SWE26_205mDRAFT_10093161	F047673	N/A	MFVDQIFEECAEILGTTDEKRVYRKITQAVQTLMESGHWMQSTADVDVCTGWDGCTIALPRGIDVPLAVNVDGSPVYFRNRLFQYHVNKGGKFNTVEWAWDDRGYVATLMQIIQPSQLVAIAESENDVGKIIRVTGTDSNNRDLRSQLK