Scaffold TDF_MC_ARG01_113mDRAFT_c1000733

Overview

Basic Information

• Taxon OID: 3300000125
• Scaffold ID: TDF_MC_ARG01_113mDRAFT_c1000733
• Source Dataset Name: Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 01_11.3m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 3093
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location

• Location Name: MC site, Ushuaia Bay, Tierra del Fuego, Argentina
• Coordinates
  • Lat. (^o): -54.810872
  • Long. (^o): -68.295525
  • Depth (m): 11.3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009032	Metagenome / Metatranscriptome	324	Y

Sequences

Protein ID	Family	RBS	Sequence
TDF_MC_ARG01_113mDRAFT_10007331	F009032	N/A	MKKFRKYSFGSKGAATTKINALGTITDAEGNEMPSHPHAIVHLGNLVEVAGTYDEEGNELTAPVMSSSYHIDV