Scaffold TDF_OR_ARG04_123mDRAFT_c1028332

Overview

Basic Information

• Taxon OID: 3300000122
• Scaffold ID: TDF_OR_ARG04_123mDRAFT_c1028332
• Source Dataset Name: Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site OR sample ARG 04_12.3m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 541
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location

• Location Name: OR site, Ushuaia Bay, Tierra del Fuego, Argentina
• Coordinates
  • Lat. (^o): -54.80407
  • Long. (^o): -68.288208
  • Depth (m): 12.3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005817	Metagenome / Metatranscriptome	389	N

Sequences

Protein ID	Family	RBS	Sequence
TDF_OR_ARG04_123mDRAFT_10283323	F005817	N/A	KKGLEDNKVRYPSMTNDIEFLLTQIFYYDDLTVRQVLNIFVFSDMEYLDRDSFSWRYGEDVFEIENNVA*