Scaffold TDF_OR_ARG04_123mDRAFT_c1012686

Overview

Basic Information

• Taxon OID: 3300000122
• Scaffold ID: TDF_OR_ARG04_123mDRAFT_c1012686
• Source Dataset Name: Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site OR sample ARG 04_12.3m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 798
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location

• Location Name: OR site, Ushuaia Bay, Tierra del Fuego, Argentina
• Coordinates
  • Lat. (^o): -54.80407
  • Long. (^o): -68.288208
  • Depth (m): 12.3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074896	Metagenome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
TDF_OR_ARG04_123mDRAFT_10126862	F074896	N/A	MQKTIKMKKFLLIASIILLLGFVATNLLSIAFNTDLKDAYAVENAFNSFSVNFLLEKYLPQESYYDGPQNNPSRFIEPFKLLLLGVGLIFLSLLGRKTFKR*