Scaffold TDF_OR_ARG04_113mDRAFT_c1041347

Overview

Basic Information

• Taxon OID: 3300000121
• Scaffold ID: TDF_OR_ARG04_113mDRAFT_c1041347
• Source Dataset Name: Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 03_11.3m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 546
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location

• Location Name: MC site, Ushuaia Bay, Tierra del Fuego, Argentina
• Coordinates
  • Lat. (^o): -54.810872
  • Long. (^o): -68.295525
  • Depth (m): 11.3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052604	Metagenome / Metatranscriptome	142	Y

Sequences

Protein ID	Family	RBS	Sequence
TDF_OR_ARG04_113mDRAFT_10413472	F052604	N/A	MITTKNQAIQFLTTMQQLFPFVHPEDDLTKIEPPFTSEQIEYLEHCFNQCYEVLPDPCDTILTEIRPTMPMFNSKL*