Scaffold KGI_S1_ANT01_95mDRAFT_c10079828

Overview

Basic Information

• Taxon OID: 3300000119
• Scaffold ID: KGI_S1_ANT01_95mDRAFT_c10079828
• Source Dataset Name: Marine microbial communities from chronically polluted sediments in Antarctica -King George Island site S1 sample ANT 01_9.5m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1024
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Sagittula → unclassified Sagittula → Sagittula sp. P11 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location

• Location Name: S1 site, Potter Cove, King George Island, Antarctic Peninsula
• Coordinates
  • Lat. (^o): -62.230512
  • Long. (^o): -58.656117
  • Depth (m): 9.5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073087	Metagenome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
KGI_S1_ANT01_95mDRAFT_100798281	F073087	AGGA	MNTQHHTSFIKAILSPTQRLFRSKTNYSLLANHHINAHTMRDIGINPIEMP*