Scaffold DelMOSum2010_c10232633

Overview

Basic Information

• Taxon OID: 3300000101
• Scaffold ID: DelMOSum2010_c10232633
• Source Dataset Name: Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 593
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage SynMITS9220M01 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Microbial Communities From Delaware Coast

Source Dataset Sampling Location

• Location Name: Microbial Observatory off the coast of Delaware, USA
• Coordinates
  • Lat. (^o): 38.84917
  • Long. (^o): -75.1076
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033992	Metagenome / Metatranscriptome	176	N

Sequences

Protein ID	Family	RBS	Sequence
DelMOSum2010_102326332	F033992	GGAG	MTHKYDLTDQSEIDMLDEVDGEYYNWDQNHSGYLWLTDECVDKYGLERGMDVEPIDWNIWNDDDDLEMRDKGFKWDFHIQQYASVHTKDGXXLRDXTYEXWEVCKANGIKEEMLSDPGCEIMGWCDG*