Scaffold LCrCPGB2aDRAFT_c095343

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold LCrCPGB2aDRAFT_c095343

Scaffold LCrCPGB2aDRAFT_c095343

Overview

Basic Information
Taxon OID	3300000095 Open in IMG/M
Scaffold ID	LCrCPGB2aDRAFT_c095343 Open in IMG/M
Source Dataset Name	Soil microbial communities from Colorado Plateau, Green Butte sample - Light Crust, Colorado Plateau, Green Butte 2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	503
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert

Source Dataset Sampling Location
Location Name	USA: Maryland: Natonal Institute of Health
Coordinates	Lat. (^o)	39.0042816	Long. (^o)	-77.1012173	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007252	Metagenome / Metatranscriptome	354	Y

Sequences

Protein ID	Family	RBS	Sequence
LCrCPGB2aDRAFT_0953431	F007252	GAG	MKKSKQKSKDGRGGARPGAGGGCRWKHGRTKLVRLPVALLDEILEVARYMDQNEGRLPSSAPPVIISGHPSESLSGEELEEFFAKKKAQKLAEQVMRGDEWVLVSDETFAGF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.