NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Draft_c017705

Scaffold Draft_c017705


Overview

Basic Information
Taxon OID3300000052 Open in IMG/M
Scaffold IDDraft_c017705 Open in IMG/M
Source Dataset NameCoal bed methane well microbial communities from Alberta, Canada
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)679
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameAlberta, Canada
CoordinatesLat. (o)52.119Long. (o)-113.78Alt. (m)Depth (m)686
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010898Metagenome297Y

Sequences

Protein IDFamilyRBSSequence
Draft_0177051F010898N/AISNFTVRIPQNLLRLEQGEHFSLNVNGFYXYNSWXNCIDGFNNEFQIIIKNMNDEITETYHYKLNDGNPNVNDVKTNLNGLLINKVLVSYDKQRNKFIFKRSLPVSTQNYTMYLNIINSEDFLGFYKSDRNINILLPYLNNVFSNNIV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.