Scaffold ARSoilOldRDRAFT_c014122

Overview

Basic Information

• Taxon OID: 3300000044
• Scaffold ID: ARSoilOldRDRAFT_c014122
• Source Dataset Name: Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil old
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 679
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere → Arabidopsis Rhizosphere Microbial Communities From The University Of North Carolina

Source Dataset Sampling Location

• Location Name: University of North Carolina, USA
• Coordinates
  • Lat. (^o): 35.9
  • Long. (^o): -79.05

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034968	Metagenome	173	Y

Sequences

Protein ID	Family	RBS	Sequence
ARSoilOldRDRAFT_0141222	F034968	AGG	LLVGIFVGIMKGQEARQKWLSKKKIKYESKKANQRNSIADGSQVVLDEIEMATYHS*