Scaffold ARcpr5yngRDRAFT_c017438

Overview

Basic Information

• Taxon OID: 3300000043
• Scaffold ID: ARcpr5yngRDRAFT_c017438
• Source Dataset Name: Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 603
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere → Arabidopsis Rhizosphere Microbial Communities From The University Of North Carolina

Source Dataset Sampling Location

• Location Name: University of North Carolina, USA
• Coordinates
  • Lat. (^o): 35.9
  • Long. (^o): -79.05

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014324	Metagenome / Metatranscriptome	264	Y

Sequences

Protein ID	Family	RBS	Sequence
ARcpr5yngRDRAFT_0174382	F014324	AGGAGG	METGRARFYAMSFVALLLALPACTSQTVKMIQPQTGATAECSGSSVGIGPLFSESFVDGCSRAYENRGYVAVQRLTPEERASLERRGLLPKD*