Scaffold Draft_c0124258

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Draft_c0124258

Scaffold Draft_c0124258

Overview

Basic Information
Taxon OID	3300000032 Open in IMG/M
Scaffold ID	Draft_c0124258 Open in IMG/M
Source Dataset Name	Oil sands microbial community from Northern Alberta which degrade Naphthaline
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	McGill University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2317
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location Name	Syncrude tailings pond, Wood Buffalo, Alberta, Canada
Coordinates	Lat. (^o)	57.02	Long. (^o)	-111.55	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052017	Metagenome / Metatranscriptome	143	N

Sequences

Protein ID	Family	RBS	Sequence
Draft_01242581	F052017	AGGAG	MQRGCLTKDDVERFEGELGKLIVVKKALELALINPAIRDDQKMTYSRALLQCERTQREFRRALIAMKVGLARWASKGRIVQAA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.