Basic Information | |
---|---|
Taxon OID | 2236876023 Open in IMG/M |
Scaffold ID | PC6_p0471821 Open in IMG/M |
Source Dataset Name | Saline water concentrator pond microbial communities from Bras del Port saltern, Spain - PC6 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | GATC-Biotech AG, Konstanz, Germany |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 980 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water Concentrator Pond → Saline Water Concentrator Pond Microbial Communities From Bras Del Port Saltern, Santa Pola, Spain |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Punta Cormorant, Spain | |||||||
Coordinates | Lat. (o) | 38.11 | Long. (o) | -0.36 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F039532 | Metagenome / Metatranscriptome | 163 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
PC6_04718212 | F039532 | AGGGGG | MAPNYYDYLPEGNFTEDDLWEAIAEAAGVDVSEIADGDLVEWL |
⦗Top⦘ |