Scaffold DUSEL06_c02938

Overview

Basic Information

• Taxon OID: 2236876016
• Scaffold ID: DUSEL06_c02938
• Source Dataset Name: Mine water biofilm microbial communities from Lead, South Dakota, sample from rock fracture pool HS4850BF040511-1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Florida
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1271
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Deep Underground Science And Engineering Laboratory Groundwater → Deep Underground Science And Engineering Laboratory Groundwater Microbial Communities From South Dakota, Us

Source Dataset Sampling Location

• Location Name: Deep Underground Science and Engineering Laboratory, Lead, SD, USA
• Coordinates
  • Lat. (^o): 44.3427
  • Long. (^o): -103.7606
  • Depth (m): 1478

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043261	Metagenome / Metatranscriptome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
DUSEL06_029381	F043261	N/A	KCKTHGRASRYEVSPQEREQRRKIALAARIQKETRLRILQSVRQELPGALSRADFEMVALDYFRRLGHDNHHRLFQVYGWEEKKTKTSWGGMSVEHEKLALDRIRSMSIADLNRFMVTCGIVPDLYYSGFGGDDVLSKDSNLSQAASRHKISAAKIASAVRAELSARTRNSRGKKRASKKRKAE