Scaffold none_p213812

Overview

Basic Information

• Taxon OID: 2236876008
• Scaffold ID: none_p213812
• Source Dataset Name: Marine microbial communities from Columbia River, CM, sample from Cape Meares, GS311-3LG-Deep1200
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of South Carolina
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 528
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location

• Location Name: Cape Meares
• Coordinates
  • Lat. (^o): 45.483
  • Long. (^o): -124.918
  • Depth (m): 1200

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068135	Metagenome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
none_2138122	F068135	N/A	KVGDIVLIKSSAGDVIPPFHVKLVERIKRKPPKDPEYIMWRAHLTKPKEADKLRKEWHIPFKFPNEVETFVCETNIIKLIKADG